SCOPe 2.08: Domain d7nxcb_: 7nxc B:

Lineage for d7nxcb_ (7nxc B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)
   automatically mapped to Pfam PF09408

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
   part of PfamB PB000266

6. Protein Spike protein S1 [143589] (5 species)

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (118 PDB entries)

8. Domain d7nxcb_: 7nxc B: [402608]
   Other proteins in same PDB: d7nxca_
   automated match to d2dd8s1
   complexed with nag

Details for d7nxcb_

PDB Entry: 7nxc, 3.14 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 p.1 variant spike glycoprotein in complex with ace2

PDB Compounds: (B:) Spike protein S1

SCOPe Domain Sequences for d7nxcb_:

Sequence; same for both SEQRES and ATOM records:

>d7nxcb_ d.318.1.1 (B:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf
tnvyadsfvirgdevrqiapgqtgtiadynyklpddftgcviawnsnnldskvggnynyl
yrlfrksnlkpferdisteiyqagstpcngvkgfncyfplqsygfqptygvgyqpyrvvv
lsfellhapatvcgk

Timeline for d7nxcb_:

• d7nxcb_ first appeared in SCOPe 2.07