Lineage for d7nena_ (7nen A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700279Superfamily a.24.12: Outer surface protein C (OspC) [63515] (2 families) (S)
  5. 2700292Family a.24.12.0: automated matches [191444] (1 protein)
    not a true family
  6. 2700293Protein automated matches [190656] (3 species)
    not a true protein
  7. 2700294Species Borrelia garinii [TaxId:29519] [402606] (1 PDB entry)
  8. 2700295Domain d7nena_: 7nen A: [402607]
    automated match to d1g5za_

Details for d7nena_

PDB Entry: 7nen (more details), 1.98 Å

PDB Description: crystal structure of outer surface protein c (ospc) from borrelia garinii
PDB Compounds: (A:) outer surface protein c

SCOPe Domain Sequences for d7nena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nena_ a.24.12.0 (A:) automated matches {Borrelia garinii [TaxId: 29519]}
ltviskkitdsnavvlavkeveallssidelakaigqkidrnnglaveanfntsllagay
tistlitkkldeliknsgelkgevekakncseaftnklkektqelavaagaatdidakka
ilktnrdkdlgadelgklfksveslskaaqeasansvkel

SCOPe Domain Coordinates for d7nena_:

Click to download the PDB-style file with coordinates for d7nena_.
(The format of our PDB-style files is described here.)

Timeline for d7nena_: