SCOPe 2.07: Domain d7nx7l1: 7nx7 L:1-107

Lineage for d7nx7l1 (7nx7 L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7nx7l1: 7nx7 L:1-107 [402600]
   Other proteins in same PDB: d7nx7b1, d7nx7b2, d7nx7e_, d7nx7l2
   automated match to d1dn0a1
   complexed with cit, cl, gol, nag, so4; mutant

Details for d7nx7l1

PDB Entry: 7nx7, 2.3 Å

PDB Description: crystal structure of the k417n mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs

PDB Compounds: (L:) EY6A Fab light chain

SCOPe Domain Sequences for d7nx7l1:

Sequence; same for both SEQRES and ATOM records:

>d7nx7l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystlaltfgggtkvei

Timeline for d7nx7l1:

• d7nx7l1 is new in SCOPe 2.07-stable
  
• d7nx7l1 appears in the current release, SCOPe 2.08