Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein "knob" domain [49837] (18 species) |
Species Human adenovirus d serotype 15 [TaxId:28276] [402581] (1 PDB entry) |
Domain d6stwb_: 6stw B: [402582] automated match to d4k6ta_ |
PDB Entry: 6stw (more details), 1.37 Å
SCOPe Domain Sequences for d6stwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6stwb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus d serotype 15 [TaxId: 28276]} dkltlwttpdpspnckiiedkdskltliltkcgsqilgsvsllvvkgkfsninnttnpne adkqitvkllfdangvlkqgstmdssywnyrsdnsnlsqpykkavgfmpsktaypkqtkp tnkeisqaknkivsnvylggkidqpcviiisfneeadsdysivfyfkwyktyenvqfdss sfnfsyiaqe
Timeline for d6stwb_: