Lineage for d1kuh__ (1kuh -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.1: Zinc protease [55487] (1 protein) Protein Zinc protease [55488] (1 species) Species Streptomyces caespitosus [TaxId:53502] [55489] (1 PDB entry) 
Domain d1kuh__: 1kuh - [40258]
Details for d1kuh__
PDB Entry: 1kuh (more details), 1.6 Å
PDB Description: zinc protease from streptomyces caespitosus
SCOP Domain Sequences for d1kuh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuh__ d.92.1.1 (-) Zinc protease {Streptomyces caespitosus}
tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang
SCOP Domain Coordinates for d1kuh__:
Click to download the PDB-style file with coordinates for d1kuh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kuh__:
- d1kuh__ appears in SCOP 1.57
- d1kuh__ appears in the current release, SCOPe 2.08, called d1kuha_
View in 3D