Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Serratia proteamaculans [TaxId:28151] [395713] (5 PDB entries) |
Domain d7ne5a2: 7ne5 A:412-677 [402559] Other proteins in same PDB: d7ne5a1 automated match to d3iula2 complexed with spm; mutant |
PDB Entry: 7ne5 (more details), 1.88 Å
SCOPe Domain Sequences for d7ne5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ne5a2 c.69.1.0 (A:412-677) automated matches {Serratia proteamaculans [TaxId: 28151]} enyrservwvkardgvevpvslvyrhdsfargtnplmvygygsygssmdpafsasrlsll drgfvfvlahirgggelgqlwyedgklfkkqntfndfidvtealiaqgygdakrvfamgg aaggllmgavinqapelfngivaqvpfvdvvttmldesiplttgeydewgnpnqqayydy ilqyspydqvkaqdyphmlvttglhdsqvqywepakwvaklrelktddrqlllytdmdsg hggksgrfkayedialeyafilalae
Timeline for d7ne5a2: