Lineage for d7ne5a2 (7ne5 A:412-677)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903017Species Serratia proteamaculans [TaxId:28151] [395713] (5 PDB entries)
  8. 2903018Domain d7ne5a2: 7ne5 A:412-677 [402559]
    Other proteins in same PDB: d7ne5a1
    automated match to d3iula2
    complexed with spm; mutant

Details for d7ne5a2

PDB Entry: 7ne5 (more details), 1.88 Å

PDB Description: catalytically non active s532a mutant of oligopeptidase b from s. proteomaculans with modified hinge region
PDB Compounds: (A:) oligopeptidase b

SCOPe Domain Sequences for d7ne5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ne5a2 c.69.1.0 (A:412-677) automated matches {Serratia proteamaculans [TaxId: 28151]}
enyrservwvkardgvevpvslvyrhdsfargtnplmvygygsygssmdpafsasrlsll
drgfvfvlahirgggelgqlwyedgklfkkqntfndfidvtealiaqgygdakrvfamgg
aaggllmgavinqapelfngivaqvpfvdvvttmldesiplttgeydewgnpnqqayydy
ilqyspydqvkaqdyphmlvttglhdsqvqywepakwvaklrelktddrqlllytdmdsg
hggksgrfkayedialeyafilalae

SCOPe Domain Coordinates for d7ne5a2:

Click to download the PDB-style file with coordinates for d7ne5a2.
(The format of our PDB-style files is described here.)

Timeline for d7ne5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7ne5a1