Lineage for d7nx6l1 (7nx6 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755532Domain d7nx6l1: 7nx6 L:1-107 [402547]
    Other proteins in same PDB: d7nx6a_, d7nx6b1, d7nx6b2, d7nx6e_, d7nx6h_, d7nx6l2
    automated match to d1dn0a1
    complexed with cl, gol, nag, so4

Details for d7nx6l1

PDB Entry: 7nx6 (more details), 2.25 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in complex with covox-222 and ey6a fabs
PDB Compounds: (L:) EY6A Fab light chain

SCOPe Domain Sequences for d7nx6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nx6l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystlaltfgggtkvei

SCOPe Domain Coordinates for d7nx6l1:

Click to download the PDB-style file with coordinates for d7nx6l1.
(The format of our PDB-style files is described here.)

Timeline for d7nx6l1: