SCOPe 2.07: Domain d7nqsb2: 7nqs B:219-414

Lineage for d7nqsb2 (7nqs B:219-414)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)

8. Domain d7nqsb2: 7nqs B:219-414 [402541]
   automated match to d3fe1a2
   complexed with an2, gol, jh1, pg4, po4

Details for d7nqsb2

PDB Entry: 7nqs, 2.56 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain in complex with z1203107138

PDB Compounds: (B:) Heat shock protein 70

SCOPe Domain Sequences for d7nqsb2:

Sequence; same for both SEQRES and ATOM records:

>d7nqsb2 c.55.1.0 (B:219-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
gkgeqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkk
nggkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcm
dqfrntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpde
avaygaavqaailsgd

Timeline for d7nqsb2:

• d7nqsb2 is new in SCOPe 2.07-stable
  
• d7nqsb2 appears in the current release, SCOPe 2.08