SCOPe 2.07: Domain d7nqvb1: 7nqv B:33-218

Lineage for d7nqvb1 (7nqv B:33-218)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)

8. Domain d7nqvb1: 7nqv B:33-218 [402536]
   automated match to d3fe1a1
   complexed with an2, cl, gol, jhj, pg4, po4

Details for d7nqvb1

PDB Entry: 7nqv, 2.37 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain in complex with z321318226

PDB Compounds: (B:) Heat shock protein 70

SCOPe Domain Sequences for d7nqvb1:

Sequence; same for both SEQRES and ATOM records:

>d7nqvb1 c.55.1.0 (B:33-218) automated matches {Plasmodium falciparum [TaxId: 36329]}
evaigidlgttyscvgicrngvvdiiandqgnrttpsyvaftdterligdaaknqasrnp
entvfdakrligrkfsettvqsdmkhwpftvkggsdgkpmievsyqgekktfhpeeissm
vlkkmkevaetylgkpvknavitvpayfndsqrqatkdagaiaglnvlriineptaaaia
ygldkk

Timeline for d7nqvb1:

• d7nqvb1 is new in SCOPe 2.07-stable
  
• d7nqvb1 does not appear in SCOPe 2.08