Lineage for d1ds7a_ (1ds7 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34274Fold d.90: NADH oxidase/flavin reductase [55468] (1 superfamily)
  4. 34275Superfamily d.90.1: NADH oxidase/flavin reductase [55469] (1 family) (S)
  5. 34276Family d.90.1.1: NADH oxidase/flavin reductase [55470] (3 proteins)
  6. 34289Protein Nitroreductase [55476] (3 species)
  7. 34295Species Escherichia coli, minor form [55478] (1 PDB entry)
  8. 34296Domain d1ds7a_: 1ds7 A: [40253]

Details for d1ds7a_

PDB Entry: 1ds7 (more details), 2.06 Å

PDB Description: a minor fmn-dependent nitroreductase from escherichia coli b

SCOP Domain Sequences for d1ds7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds7a_ d.90.1.1 (A:) Nitroreductase {Escherichia coli, minor form}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOP Domain Coordinates for d1ds7a_:

Click to download the PDB-style file with coordinates for d1ds7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ds7a_: