SCOPe 2.08: Domain d7nowa_: 7now A:

Lineage for d7nowa_ (7now A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d7nowa_: 7now A: [402527]
   automated match to d4w81a_
   complexed with na, so4

Details for d7nowa_

PDB Entry: 7now, 1.85 Å

PDB Description: complex of nucleoporin-98 and nanobody ms98-27 solved at 1.85a resolution

PDB Compounds: (A:) Anti-Nup98 nanobody MS98-27

SCOPe Domain Sequences for d7nowa_:

Sequence; same for both SEQRES and ATOM records:

>d7nowa_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]}
gqvqlvesggglvqaggslrlscaasgrtfstyamgwfrqapgkerefvsacswsggitr
yadsvkgrftisrdnakntvylqmnslkpedtavyycasaassaaysgayyytsyydywg
qgtqvtvss

Timeline for d7nowa_:

• d7nowa_ first appeared in SCOPe 2.07