Lineage for d1necb_ (1nec B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34274Fold d.90: NADH oxidase/flavin reductase [55468] (1 superfamily)
  4. 34275Superfamily d.90.1: NADH oxidase/flavin reductase [55469] (1 family) (S)
  5. 34276Family d.90.1.1: NADH oxidase/flavin reductase [55470] (3 proteins)
  6. 34289Protein Nitroreductase [55476] (3 species)
  7. 34290Species Enterobacter cloacae [TaxId:550] [55477] (1 PDB entry)
  8. 34292Domain d1necb_: 1nec B: [40250]

Details for d1necb_

PDB Entry: 1nec (more details), 1.95 Å

PDB Description: nitroreductase from enterobacter cloacae

SCOP Domain Sequences for d1necb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1necb_ d.90.1.1 (B:) Nitroreductase {Enterobacter cloacae}
diisvalkrhstkafdaskkltaeeaekiktllqyspsstnsqpwhfivasteegkarva
ksaagtyvfnerkmldashvvvfcaktamddawlervvdqeeadgrfntpeakaanhkgr
tyfadmhrvdlkdddqwmakqvylnvgnfllgvgamgldavpiegfdaaildeefglkek
gftslvvvpvghhsvedfnatlpksrlplstivtec

SCOP Domain Coordinates for d1necb_:

Click to download the PDB-style file with coordinates for d1necb_.
(The format of our PDB-style files is described here.)

Timeline for d1necb_: