Lineage for d7dkze1 (7dkz E:1-59)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393514Species Pea (Pisum sativum) [TaxId:3888] [311431] (7 PDB entries)
  8. 2393515Domain d7dkze1: 7dkz E:1-59 [402497]
    Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze2, d7dkzf_, d7dkzj_
    automated match to d4y28e_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkze1

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (E:) PsaE

SCOPe Domain Sequences for d7dkze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkze1 b.34.4.0 (E:1-59) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyalde

SCOPe Domain Coordinates for d7dkze1:

Click to download the PDB-style file with coordinates for d7dkze1.
(The format of our PDB-style files is described here.)

Timeline for d7dkze1: