SCOPe 2.08: Domain d7dkze1: 7dkz E:1-59

Lineage for d7dkze1 (7dkz E:1-59)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [311431] (8 PDB entries)

8. Domain d7dkze1: 7dkz E:1-59 [402497]
   Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze2, d7dkzf_, d7dkzj_, d7dkzl_
   automated match to d4y28e_
   complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkze1

PDB Entry: 7dkz, 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex

PDB Compounds: (E:) PsaE

SCOPe Domain Sequences for d7dkze1:

Sequence; same for both SEQRES and ATOM records:

>d7dkze1 b.34.4.0 (E:1-59) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyalde

Timeline for d7dkze1:

• d7dkze1 first appeared in SCOPe 2.07