Lineage for d7ljua5 (7lju A:845-1017)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949247Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2949248Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2949253Domain d7ljua5: 7lju A:845-1017 [402496]
    Other proteins in same PDB: d7ljua1, d7ljua2, d7ljua3, d7ljua4, d7ljub1, d7ljub2, d7ljub3, d7ljub4, d7ljuc1, d7ljuc2, d7ljuc3, d7ljuc4, d7ljud1, d7ljud2, d7ljud3, d7ljud4
    automated match to d1gtea5
    complexed with fad, fnr, nap, sf4, y3g

Details for d7ljua5

PDB Entry: 7lju (more details), 1.87 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) crosslinked with 5- ethynyluracil (5eu)
PDB Compounds: (A:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljua5:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljua5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl

SCOPe Domain Coordinates for d7ljua5:

Click to download the PDB-style file with coordinates for d7ljua5.
(The format of our PDB-style files is described here.)

Timeline for d7ljua5: