Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Kribbella flavida [TaxId:479435] [402436] (2 PDB entries) |
Domain d6m6la1: 6m6l A:1-446 [402490] Other proteins in same PDB: d6m6la2 automated match to d2e3zb_ complexed with edo, gol, xyp |
PDB Entry: 6m6l (more details), 1.5 Å
SCOPe Domain Sequences for d6m6la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m6la1 c.1.8.0 (A:1-446) automated matches {Kribbella flavida [TaxId: 479435]} mvelsplrqdfvwgtatsayqiegavaddgrlpsiwdtfcrvpgaidngdtgdvacdsyh rwpedlallkqlgvdayrfsiawprviptgsgavntagldyydrvvddllaegikpfvtl yhwdlpqalqdlggwdnrdtayrfaeyaavvgaklgdrvrdwvtlneplcsawighwegr mapgitdpaiavrasynlllahglgvaalrdacpeppavglvvnlsgcepasqspedira ariadghinrwwldptsgrgfpadmvetygvelperpgdleiiaaptdfiglnyyfrqii eadgsvpvlgfsqvpgpnaehtmidwevhpagleelilrlakeygaekiyvtengsawvd qpdaefavddpdrtayleehlaacvraveqgaplagyfawslmdnfewaygyaprfglay vdyptgtrvmktsgkryadlirghre
Timeline for d6m6la1: