Lineage for d7ljtd5 (7ljt D:845-1019)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949247Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2949248Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2949264Domain d7ljtd5: 7ljt D:845-1019 [402462]
    Other proteins in same PDB: d7ljta1, d7ljta2, d7ljta3, d7ljta4, d7ljtb1, d7ljtb2, d7ljtb3, d7ljtb4, d7ljtc1, d7ljtc2, d7ljtc3, d7ljtc4, d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd4
    automated match to d1gted5
    complexed with fad, fmn, nap, sf4, y3g

Details for d7ljtd5

PDB Entry: 7ljt (more details), 1.98 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) soaked with 5- ethynyluracil (5eu), nadph - 20 minutes
PDB Compounds: (D:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljtd5:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljtd5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl

SCOPe Domain Coordinates for d7ljtd5:

Click to download the PDB-style file with coordinates for d7ljtd5.
(The format of our PDB-style files is described here.)

Timeline for d7ljtd5: