| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
| Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
| Domain d7ljtd5: 7ljt D:845-1019 [402462] Other proteins in same PDB: d7ljta1, d7ljta2, d7ljta3, d7ljta4, d7ljtb1, d7ljtb2, d7ljtb3, d7ljtb4, d7ljtc1, d7ljtc2, d7ljtc3, d7ljtc4, d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd4 automated match to d1gted5 complexed with fad, fmn, nap, sf4, y3g |
PDB Entry: 7ljt (more details), 1.98 Å
SCOPe Domain Sequences for d7ljtd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljtd5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl
Timeline for d7ljtd5:
View in 3DDomains from same chain: (mouse over for more information) d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd4 |