![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries) |
![]() | Domain d7ljtd4: 7ljt D:533-844 [402461] Other proteins in same PDB: d7ljta1, d7ljta2, d7ljta3, d7ljta5, d7ljtb1, d7ljtb2, d7ljtb3, d7ljtb5, d7ljtc1, d7ljtc2, d7ljtc3, d7ljtc5, d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd5 automated match to d1gted2 complexed with fad, fmn, nap, sf4, y3g has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 7ljt (more details), 1.98 Å
SCOPe Domain Sequences for d7ljtd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljtd4 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d7ljtd4:
![]() Domains from same chain: (mouse over for more information) d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd5 |