![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
![]() | Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries) |
![]() | Domain d7ljtd1: 7ljt D:3-183 [402458] Other proteins in same PDB: d7ljta2, d7ljta3, d7ljta4, d7ljta5, d7ljtb2, d7ljtb3, d7ljtb4, d7ljtb5, d7ljtc2, d7ljtc3, d7ljtc4, d7ljtc5, d7ljtd2, d7ljtd3, d7ljtd4, d7ljtd5 automated match to d1gted1 complexed with fad, fmn, nap, sf4, y3g |
PDB Entry: 7ljt (more details), 1.98 Å
SCOPe Domain Sequences for d7ljtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljtd1 a.1.2.2 (D:3-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} pvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfddi khttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnpl gltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqekm p
Timeline for d7ljtd1:
![]() Domains from same chain: (mouse over for more information) d7ljtd2, d7ljtd3, d7ljtd4, d7ljtd5 |