Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Streptococcus agalactiae [TaxId:1311] [402353] (1 PDB entry) |
Domain d6m6te1: 6m6t E:3-498 [402446] Other proteins in same PDB: d6m6tb2, d6m6tc2, d6m6tc3, d6m6te2, d6m6tg2 automated match to d1eswa_ |
PDB Entry: 6m6t (more details), 2.75 Å
SCOPe Domain Sequences for d6m6te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m6te1 c.1.8.1 (E:3-498) automated matches {Streptococcus agalactiae [TaxId: 1311]} krasgvlmhitslpgdlgigtfgreayafvdflvetdqkfwqilpltttsfgdspyqsfs avagnthlidfdlltlegfiskddyqnisfgqdpevvdyaglfekrrpvlekavknflke eratrmlsdflqeekwvtdfaefmaikehfgnkalqewddkaiirreeealagyrqklse vikyhevtqyffykqwfelkeyandkgiqiigdmpiyvsadsvevwtmpelfkldrdkqp laiagvpaddfsddgqlwgnpiynwdyhkesdfdwwiyriqsgvkmydylridhfkgfsd yweirgdyqtandgswqpapgpelfatikeklgdlpiiaenlgyideraerllagtgfpg mkimefgfydttgnsidiphnytentiayagthdnevingwfenltveqkayaenymrrl pnepitetvlrtlyatvsqttitcmqdlldkpadsrmnmpntvggnwqwrmrkedltenr kaflkeittiynrgnk
Timeline for d6m6te1: