Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [275309] (3 PDB entries) |
Domain d7m1mh_: 7m1m H: [402433] automated match to d5e0sb_ complexed with mpd |
PDB Entry: 7m1m (more details), 2.6 Å
SCOPe Domain Sequences for d7m1mh_:
Sequence, based on SEQRES records: (download)
>d7m1mh_ c.14.1.0 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lvpmvveqsargeraydiysrllkeriiflvgqvedymanlvvaqllfleaenpekdihl yinspggsvtagmsiydtmqfikpnvsttcigqacsmgalllaggaagkryclphsrmmi hqplggfqgqasdieihakeilfikerlnqilahhtgqpldviardtdrdrfmsgdeavk yglidkvmtqr
>d7m1mh_ c.14.1.0 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lvpmvaydiysrllkeriiflvgqvedymanlvvaqllfleaenpekdihlyinspggsv tagmsiydtmqfikpnvsttcigqacsmgalllaggaagkryclphsrmmihqplggfqg qasdieihakeilfikerlnqilahhtgqpldviardtdrdrfmsgdeavkyglidkvmt qr
Timeline for d7m1mh_: