SCOPe 2.04: Domain d1noxa_: 1nox A:

Lineage for d1noxa_ (1nox A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein NADH oxidase [55471] (1 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [55472] (1 PDB entry)

8. Domain d1noxa_: 1nox A: [40242]
   complexed with fmn

Details for d1noxa_

PDB Entry: 1nox, 1.59 Å

PDB Description: nadh oxidase from thermus thermophilus

PDB Compounds: (A:) nadh oxidase

SCOPe Domain Sequences for d1noxa_:

Sequence; same for both SEQRES and ATOM records:

>d1noxa_ d.90.1.1 (A:) NADH oxidase {Thermus thermophilus HB8 [TaxId: 300852]}
pvldaktaalkrrsirryrkdpvpegllreileaalrapsawnlqpwrivvvrdpatkra
lreaafgqahveeapvvlvlyadledalahldevihpgvqgerreaqkqaiqrafaamgq
earkawasgqsyillgyllllleayglgsvpmlgfdpervrailglpsraaipalvalgy
paeegypshrlplervvlwr

Timeline for d1noxa_:

• d1noxa_ first appeared (with stable ids) in SCOP 1.55, called d1nox__
  
• d1noxa_ appears in SCOPe 2.03
  
• d1noxa_ appears in SCOPe 2.05
  
• d1noxa_ appears in the current release, SCOPe 2.08