![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
![]() | Protein NADH oxidase [55471] (1 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [55472] (1 PDB entry) |
![]() | Domain d1noxa_: 1nox A: [40242] complexed with fmn |
PDB Entry: 1nox (more details), 1.59 Å
SCOPe Domain Sequences for d1noxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1noxa_ d.90.1.1 (A:) NADH oxidase {Thermus thermophilus HB8 [TaxId: 300852]} pvldaktaalkrrsirryrkdpvpegllreileaalrapsawnlqpwrivvvrdpatkra lreaafgqahveeapvvlvlyadledalahldevihpgvqgerreaqkqaiqrafaamgq earkawasgqsyillgyllllleayglgsvpmlgfdpervrailglpsraaipalvalgy paeegypshrlplervvlwr
Timeline for d1noxa_: