SCOPe 2.07: Domain d6m5ya2: 6m5y A:136-272

Lineage for d6m5ya2 (6m5y A:136-272)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
   Uniprot P09382

8. Domain d6m5ya2: 6m5y A:136-272 [402418]
   automated match to d2zkna_
   complexed with bgc, gal, glc; mutant

Details for d6m5ya2

PDB Entry: 6m5y, 1.38 Å

PDB Description: structure of human galectin-1 tandem-repeat mutant with lactose

PDB Compounds: (A:) Galectin-1,Galectin-1

SCOPe Domain Sequences for d6m5ya2:

Sequence; same for both SEQRES and ATOM records:

>d6m5ya2 b.29.1.3 (A:136-272) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
gssasglvasnlnlkpgeslrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdant
ivsnskdggawgteqreavfpfqpgsvaevsitfdqanltvklpdgyefkfpnrlnleai
nymaadgdfkiksvafd

Timeline for d6m5ya2:

• d6m5ya2 is new in SCOPe 2.07-stable
  
• d6m5ya2 appears in the current release, SCOPe 2.08