Lineage for d2tbd__ (2tbd -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607407Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 607408Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 607409Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (1 protein)
  6. 607410Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)
  7. 607411Species Simian virus 40, Sv40 [TaxId:10633] [55467] (2 PDB entries)
  8. 607412Domain d2tbd__: 2tbd - [40241]

Details for d2tbd__

PDB Entry: 2tbd (more details)

PDB Description: sv40 t antigen dna-binding domain, nmr, 30 structures

SCOP Domain Sequences for d2tbd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tbd__ d.89.1.1 (-) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40}
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnpess

SCOP Domain Coordinates for d2tbd__:

Click to download the PDB-style file with coordinates for d2tbd__.
(The format of our PDB-style files is described here.)

Timeline for d2tbd__: