Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (81 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries) |
Domain d7nbjb1: 7nbj B:1-260 [402404] Other proteins in same PDB: d7nbja2, d7nbjb2 automated match to d3roda_ complexed with gol, u7h |
PDB Entry: 7nbj (more details), 2.28 Å
SCOPe Domain Sequences for d7nbjb1:
Sequence, based on SEQRES records: (download)
>d7nbjb1 c.66.1.0 (B:1-260) automated matches {Human (Homo sapiens) [TaxId: 9606]} mesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdlli digsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegn rvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycral rnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisq sysstmanneglfslvarkl
>d7nbjb1 c.66.1.0 (B:1-260) automated matches {Human (Homo sapiens) [TaxId: 9606]} mesgftskdtylshfnprdylekyykrhsaesqilkhllknlfkifcldgvkgdllidig sgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvk gpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnl gsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsys stmanneglfslvarkl
Timeline for d7nbjb1:
View in 3D Domains from other chains: (mouse over for more information) d7nbja1, d7nbja2, d7nbjc_, d7nbjd_ |