Lineage for d1tbd__ (1tbd -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82137Fold d.89: Origin of replication-binding domain [55463] (1 superfamily)
  4. 82138Superfamily d.89.1: Origin of replication-binding domain [55464] (2 families) (S)
  5. 82139Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (1 protein)
  6. 82140Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)
  7. 82141Species Simian virus 40 [TaxId:10633] [55467] (2 PDB entries)
  8. 82142Domain d1tbd__: 1tbd - [40240]

Details for d1tbd__

PDB Entry: 1tbd (more details)

PDB Description: solution structure of the origin dna binding domain of sv40 t-antigen, nmr, minimized average structure

SCOP Domain Sequences for d1tbd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbd__ d.89.1.1 (-) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40}
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnpess

SCOP Domain Coordinates for d1tbd__:

Click to download the PDB-style file with coordinates for d1tbd__.
(The format of our PDB-style files is described here.)

Timeline for d1tbd__: