Lineage for d7m3wc_ (7m3w C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854112Species Mycolicibacterium paratuberculosis [TaxId:262316] [402394] (1 PDB entry)
  8. 2854115Domain d7m3wc_: 7m3w C: [402395]
    automated match to d3g64a_

Details for d7m3wc_

PDB Entry: 7m3w (more details), 2.9 Å

PDB Description: crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis
PDB Compounds: (C:) Enoyl-CoA hydratase EchA15

SCOPe Domain Sequences for d7m3wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m3wc_ c.14.1.0 (C:) automated matches {Mycolicibacterium paratuberculosis [TaxId: 262316]}
pvshppvdyhdfpslrcelgddgvltvvldspglnsvgpqmhrdladiwpvidrdpavra
vlvrgegkafssggsfdlidetigdyqgrvrimreardlvhnmincdtpvvsairgpavg
aglvvalladisvagrtaklidghtklgvaagdhaaicwpllvgmakakyylltcetllg
eeaeriglvslcvddddvlstaagiagklaqgaqhaiqwtkrslnhwyrmmgptfetsvg
leflsfsgpdvqeglaahrekraarft

SCOPe Domain Coordinates for d7m3wc_:

Click to download the PDB-style file with coordinates for d7m3wc_.
(The format of our PDB-style files is described here.)

Timeline for d7m3wc_: