| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (1 family) ![]() |
| Family d.88.1.1: SRF-like [55456] (5 proteins) |
| Protein Myocyte enhancer factor Mef2a core [55461] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries) |
| Domain d1c7ub_: 1c7u B: [40239] protein/DNA complex |
PDB Entry: 1c7u (more details)
SCOPe Domain Sequences for d1c7ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ub_ d.88.1.1 (B:) Myocyte enhancer factor Mef2a core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
mdkvllkyteynep
Timeline for d1c7ub_: