Lineage for d1c7ub_ (1c7u B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82114Fold d.88: SRF-like [55454] (1 superfamily)
  4. 82115Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 82116Family d.88.1.1: SRF-like [55456] (3 proteins)
  6. 82121Protein Mef2a core [55461] (1 species)
  7. 82122Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 82128Domain d1c7ub_: 1c7u B: [40239]

Details for d1c7ub_

PDB Entry: 1c7u (more details)

PDB Description: complex of the dna binding core domain of the transcription factor mef2a with a 20mer oligonucleotide

SCOP Domain Sequences for d1c7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ub_ d.88.1.1 (B:) Mef2a core {Human (Homo sapiens)}
grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
mdkvllkyteynep

SCOP Domain Coordinates for d1c7ub_:

Click to download the PDB-style file with coordinates for d1c7ub_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ub_:

82128
d1c7ub_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1c7ua_