SCOPe 2.07: Domain d7nbja1: 7nbj A:1-260

Lineage for d7nbja1 (7nbj A:1-260)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)

8. Domain d7nbja1: 7nbj A:1-260 [402389]
   Other proteins in same PDB: d7nbja2, d7nbjb2
   automated match to d3roda_
   complexed with gol, u7h

Details for d7nbja1

PDB Entry: 7nbj, 2.28 Å

PDB Description: co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (1)

PDB Compounds: (A:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d7nbja1:

Sequence; same for both SEQRES and ATOM records:

>d7nbja1 c.66.1.0 (A:1-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdlli
digsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegn
rvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycral
rnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisq
sysstmanneglfslvarkl

Timeline for d7nbja1:

• d7nbja1 is new in SCOPe 2.07-stable
  
• d7nbja1 appears in the current release, SCOPe 2.08