Lineage for d1c7ua_ (1c7u A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660301Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 1660302Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 1660303Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 1660308Protein Myocyte enhancer factor Mef2a core [55461] (1 species)
  7. 1660309Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 1660314Domain d1c7ua_: 1c7u A: [40238]
    protein/DNA complex

Details for d1c7ua_

PDB Entry: 1c7u (more details)

PDB Description: complex of the dna binding core domain of the transcription factor mef2a with a 20mer oligonucleotide
PDB Compounds: (A:) myocyte-specific enhancer factor 2a, c4 form

SCOPe Domain Sequences for d1c7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ua_ d.88.1.1 (A:) Myocyte enhancer factor Mef2a core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd
mdkvllkyteynep

SCOPe Domain Coordinates for d1c7ua_:

Click to download the PDB-style file with coordinates for d1c7ua_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c7ub_