![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186855] (10 PDB entries) |
![]() | Domain d7l9ca_: 7l9c A: [402377] automated match to d5wq0d_ |
PDB Entry: 7l9c (more details), 1.85 Å
SCOPe Domain Sequences for d7l9ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l9ca_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mtqplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdia mprmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremv faclyps
Timeline for d7l9ca_: