Lineage for d1egwc_ (1egw C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82114Fold d.88: SRF-like [55454] (1 superfamily)
  4. 82115Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 82116Family d.88.1.1: SRF-like [55456] (3 proteins)
  6. 82121Protein Mef2a core [55461] (1 species)
  7. 82122Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 82125Domain d1egwc_: 1egw C: [40236]

Details for d1egwc_

PDB Entry: 1egw (more details), 1.5 Å

PDB Description: crystal structure of mef2a core bound to dna

SCOP Domain Sequences for d1egwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egwc_ d.88.1.1 (C:) Mef2a core {Human (Homo sapiens)}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteyn

SCOP Domain Coordinates for d1egwc_:

Click to download the PDB-style file with coordinates for d1egwc_.
(The format of our PDB-style files is described here.)

Timeline for d1egwc_: