Lineage for d6m6tb1 (6m6t B:2-497)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830510Species Streptococcus agalactiae [TaxId:1311] [402353] (1 PDB entry)
  8. 2830512Domain d6m6tb1: 6m6t B:2-497 [402359]
    Other proteins in same PDB: d6m6tb2, d6m6tc2, d6m6tc3, d6m6te2, d6m6tg2
    automated match to d1eswa_

Details for d6m6tb1

PDB Entry: 6m6t (more details), 2.75 Å

PDB Description: amylomaltase from streptococcus agalactiae in complex with acarbose
PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d6m6tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m6tb1 c.1.8.1 (B:2-497) automated matches {Streptococcus agalactiae [TaxId: 1311]}
kkrasgvlmhitslpgdlgigtfgreayafvdflvetdqkfwqilpltttsfgdspyqsf
savagnthlidfdlltlegfiskddyqnisfgqdpevvdyaglfekrrpvlekavknflk
eeratrmlsdflqeekwvtdfaefmaikehfgnkalqewddkaiirreeealagyrqkls
evikyhevtqyffykqwfelkeyandkgiqiigdmpiyvsadsvevwtmpelfkldrdkq
plaiagvpaddfsddgqlwgnpiynwdyhkesdfdwwiyriqsgvkmydylridhfkgfs
dyweirgdyqtandgswqpapgpelfatikeklgdlpiiaenlgyideraerllagtgfp
gmkimefgfydttgnsidiphnytentiayagthdnevingwfenltveqkayaenymrr
lpnepitetvlrtlyatvsqttitcmqdlldkpadsrmnmpntvggnwqwrmrkedlten
rkaflkeittiynrgn

SCOPe Domain Coordinates for d6m6tb1:

Click to download the PDB-style file with coordinates for d6m6tb1.
(The format of our PDB-style files is described here.)

Timeline for d6m6tb1: