Lineage for d7dkzd_ (7dkz D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611473Species Pea (Pisum sativum) [TaxId:3888] [276208] (7 PDB entries)
  8. 2611474Domain d7dkzd_: 7dkz D: [402352]
    Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_
    automated match to d5l8rd_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzd_

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d7dkzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkzd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
ppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnllk
larkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfrs
igknvspievkftgkqpydl

SCOPe Domain Coordinates for d7dkzd_:

Click to download the PDB-style file with coordinates for d7dkzd_.
(The format of our PDB-style files is described here.)

Timeline for d7dkzd_: