| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) ![]() automatically mapped to Pfam PF02531 |
| Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
| Protein automated matches [236562] (8 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries) |
| Domain d7dkzd_: 7dkz D: [402352] Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_, d7dkzl_ automated match to d5l8rd_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 7dkz (more details), 2.39 Å
SCOPe Domain Sequences for d7dkzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dkzd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
ppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnllk
larkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfrs
igknvspievkftgkqpydl
Timeline for d7dkzd_: