SCOPe 2.08: Domain d7dkzd_: 7dkz D:

Lineage for d7dkzd_ (7dkz D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
   beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail

4. Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family)
   automatically mapped to Pfam PF02531

5. Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)

6. Protein automated matches [236562] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)

8. Domain d7dkzd_: 7dkz D: [402352]
   Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_, d7dkzl_
   automated match to d5l8rd_
   complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzd_

PDB Entry: 7dkz, 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex

PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d7dkzd_:

Sequence; same for both SEQRES and ATOM records:

>d7dkzd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
ppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnllk
larkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfrs
igknvspievkftgkqpydl

Timeline for d7dkzd_:

• d7dkzd_ first appeared in SCOPe 2.07