Lineage for d1egwb_ (1egw B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660301Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 1660302Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 1660303Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 1660308Protein Myocyte enhancer factor Mef2a core [55461] (1 species)
  7. 1660309Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 1660311Domain d1egwb_: 1egw B: [40235]
    protein/DNA complex

Details for d1egwb_

PDB Entry: 1egw (more details), 1.5 Å

PDB Description: crystal structure of mef2a core bound to dna
PDB Compounds: (B:) mads box transcription enhancer factor 2, polypeptide a

SCOPe Domain Sequences for d1egwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egwb_ d.88.1.1 (B:) Myocyte enhancer factor Mef2a core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteyn

SCOPe Domain Coordinates for d1egwb_:

Click to download the PDB-style file with coordinates for d1egwb_.
(The format of our PDB-style files is described here.)

Timeline for d1egwb_: