Lineage for d7lixd_ (7lix D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689278Species Red alga (Porphyridium purpureum) [TaxId:35688] [194584] (5 PDB entries)
  8. 2689293Domain d7lixd_: 7lix D: [402340]
    automated match to d3v57b_
    complexed with peb

Details for d7lixd_

PDB Entry: 7lix (more details), 2.8 Å

PDB Description: carsp1 and scaffolded phycoerythrin beta subunits from the phycobilisome of porphyridium purpureum
PDB Compounds: (D:) B-phycoerythrin beta chain

SCOPe Domain Sequences for d7lixd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lixd_ a.1.1.3 (D:) automated matches {Red alga (Porphyridium purpureum) [TaxId: 35688]}
mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais

SCOPe Domain Coordinates for d7lixd_:

Click to download the PDB-style file with coordinates for d7lixd_.
(The format of our PDB-style files is described here.)

Timeline for d7lixd_: