SCOPe 2.06: Domain d1egwa_: 1egw A:

Lineage for d1egwa_ (1egw A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (5 proteins)

6. Protein Myocyte enhancer factor Mef2a core [55461] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)

8. Domain d1egwa_: 1egw A: [40234]
   protein/DNA complex

Details for d1egwa_

PDB Entry: 1egw, 1.5 Å

PDB Description: crystal structure of mef2a core bound to dna

PDB Compounds: (A:) mads box transcription enhancer factor 2, polypeptide a

SCOPe Domain Sequences for d1egwa_:

Sequence; same for both SEQRES and ATOM records:

>d1egwa_ d.88.1.1 (A:) Myocyte enhancer factor Mef2a core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytey

Timeline for d1egwa_:

• d1egwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1egwa_ appears in SCOPe 2.05
  
• d1egwa_ appears in SCOPe 2.07
  
• d1egwa_ appears in the current release, SCOPe 2.08