![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
![]() | Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries) |
![]() | Domain d7ljuc1: 7lju C:3-183 [402312] Other proteins in same PDB: d7ljua2, d7ljua3, d7ljua4, d7ljua5, d7ljub2, d7ljub3, d7ljub4, d7ljub5, d7ljuc2, d7ljuc3, d7ljuc4, d7ljuc5, d7ljud2, d7ljud3, d7ljud4, d7ljud5 automated match to d1gtea1 complexed with fad, fnr, nap, sf4, y3g |
PDB Entry: 7lju (more details), 1.87 Å
SCOPe Domain Sequences for d7ljuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljuc1 a.1.2.2 (C:3-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} pvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfddi khttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnpl gltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqekm p
Timeline for d7ljuc1:
![]() Domains from same chain: (mouse over for more information) d7ljuc2, d7ljuc3, d7ljuc4, d7ljuc5 |