Lineage for d7dkzf_ (7dkz F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631500Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 2631501Protein automated matches [276199] (4 species)
    not a true protein
  7. 2631509Species Pea (Pisum sativum) [TaxId:3888] [276202] (7 PDB entries)
  8. 2631510Domain d7dkzf_: 7dkz F: [402307]
    Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzj_
    automated match to d5l8rf_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzf_

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (F:) psi-f

SCOPe Domain Sequences for d7dkzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkzf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
idvplatrlvfrgfswpiaayrellngelvak

SCOPe Domain Coordinates for d7dkzf_:

Click to download the PDB-style file with coordinates for d7dkzf_.
(The format of our PDB-style files is described here.)

Timeline for d7dkzf_: