SCOPe 2.08: Domain d7dkzf_: 7dkz F:

Lineage for d7dkzf_ (7dkz F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276202] (9 PDB entries)

8. Domain d7dkzf_: 7dkz F: [402307]
   Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzj_, d7dkzl_
   automated match to d5l8rf_
   complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzf_

PDB Entry: 7dkz, 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex

PDB Compounds: (F:) psi-f

SCOPe Domain Sequences for d7dkzf_:

Sequence; same for both SEQRES and ATOM records:

>d7dkzf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
idvplatrlvfrgfswpiaayrellngelvak

Timeline for d7dkzf_:

• d7dkzf_ first appeared in SCOPe 2.07