SCOPe 2.08: Domain d7lixc_: 7lix C:

Lineage for d7lixc_ (7lix C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Red alga (Porphyridium purpureum) [TaxId:35688] [194584] (5 PDB entries)

8. Domain d7lixc_: 7lix C: [402306]
   automated match to d3v57b_
   complexed with peb

Details for d7lixc_

PDB Entry: 7lix, 2.8 Å

PDB Description: carsp1 and scaffolded phycoerythrin beta subunits from the phycobilisome of porphyridium purpureum

PDB Compounds: (C:) B-phycoerythrin beta chain

SCOPe Domain Sequences for d7lixc_:

Sequence; same for both SEQRES and ATOM records:

>d7lixc_ a.1.1.3 (C:) automated matches {Red alga (Porphyridium purpureum) [TaxId: 35688]}
mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais

Timeline for d7lixc_:

• d7lixc_ first appeared in SCOPe 2.07