SCOP 1.57: Domain d1srsa_: 1srs A:

Lineage for d1srsa_ (1srs A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (3 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (2 PDB entries)

8. Domain d1srsa_: 1srs A: [40230]

Details for d1srsa_

PDB Entry: 1srs, 3.2 Å

PDB Description: serum response factor (srf) core complexed with specific sre dna

SCOP Domain Sequences for d1srsa_:

Sequence; same for both SEQRES and ATOM records:

>d1srsa_ d.88.1.1 (A:) Serum response factor (SRF) core {Human (Homo sapiens)}
trgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytfat
rklqpmitsetgkaliqtclnspd

Timeline for d1srsa_:

• d1srsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1srsa_ appears in SCOP 1.59
  
• d1srsa_ appears in the current release, SCOPe 2.08