Lineage for d7ljsb2 (7ljs B:184-287,B:441-532)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850289Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2850290Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2850291Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2850304Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 2850305Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries)
  8. 2850323Domain d7ljsb2: 7ljs B:184-287,B:441-532 [402295]
    Other proteins in same PDB: d7ljsa1, d7ljsa3, d7ljsa4, d7ljsa5, d7ljsb1, d7ljsb3, d7ljsb4, d7ljsb5, d7ljsc1, d7ljsc3, d7ljsc4, d7ljsc5, d7ljsd1, d7ljsd3, d7ljsd4, d7ljsd5
    automated match to d1gteb4
    complexed with fad, fmn, sf4, y3g

Details for d7ljsb2

PDB Entry: 7ljs (more details), 2 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) complexed with 5- ethynyluracil (5eu) - open form
PDB Compounds: (B:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljsb2 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d7ljsb2:

Click to download the PDB-style file with coordinates for d7ljsb2.
(The format of our PDB-style files is described here.)

Timeline for d7ljsb2: