Lineage for d1fo4a4 (1fo4 A:415-531)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135569Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 135570Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (3 proteins)
  6. 135590Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 135591Species Cow (Bos taurus) [TaxId:9913] [55453] (2 PDB entries)
  8. 135592Domain d1fo4a4: 1fo4 A:415-531 [40227]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b5, d1fo4b6

Details for d1fo4a4

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a4 d.87.2.1 (A:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus)}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds

SCOP Domain Coordinates for d1fo4a4:

Click to download the PDB-style file with coordinates for d1fo4a4.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a4: