Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Escherichia coli [TaxId:562] [186855] (10 PDB entries) |
Domain d7lcma_: 7lcm A: [402268] automated match to d5wq0d_ complexed with bef, mg |
PDB Entry: 7lcm (more details), 1.91 Å
SCOPe Domain Sequences for d7lcma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lcma_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} tqplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiam prmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremvf aclypsmf
Timeline for d7lcma_: