Lineage for d7lcma_ (7lcm A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464222Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)
  8. 2464230Domain d7lcma_: 7lcm A: [402268]
    automated match to d5wq0d_
    complexed with bef, mg

Details for d7lcma_

PDB Entry: 7lcm (more details), 1.91 Å

PDB Description: receiver domain of rssb bound to beryllofluoride
PDB Compounds: (A:) Regulator of RpoS

SCOPe Domain Sequences for d7lcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lcma_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tqplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiam
prmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremvf
aclypsmf

SCOPe Domain Coordinates for d7lcma_:

Click to download the PDB-style file with coordinates for d7lcma_.
(The format of our PDB-style files is described here.)

Timeline for d7lcma_: