![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
![]() | Domain d7ljsa5: 7ljs A:845-1017 [402247] Other proteins in same PDB: d7ljsa1, d7ljsa2, d7ljsa3, d7ljsa4, d7ljsb1, d7ljsb2, d7ljsb3, d7ljsb4, d7ljsc1, d7ljsc2, d7ljsc3, d7ljsc4, d7ljsd1, d7ljsd2, d7ljsd3, d7ljsd4 automated match to d1gtea5 complexed with fad, fmn, sf4, y3g |
PDB Entry: 7ljs (more details), 2 Å
SCOPe Domain Sequences for d7ljsa5:
Sequence, based on SEQRES records: (download)
>d7ljsa5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl
>d7ljsa5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnerk pfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgyqa iqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl
Timeline for d7ljsa5:
![]() Domains from same chain: (mouse over for more information) d7ljsa1, d7ljsa2, d7ljsa3, d7ljsa4 |