| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
| Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
| Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries) |
| Domain d7ljsa2: 7ljs A:184-287,A:441-532 [402244] Other proteins in same PDB: d7ljsa1, d7ljsa3, d7ljsa4, d7ljsa5, d7ljsb1, d7ljsb3, d7ljsb4, d7ljsb5, d7ljsc1, d7ljsc3, d7ljsc4, d7ljsc5, d7ljsd1, d7ljsd3, d7ljsd4, d7ljsd5 automated match to d1gtea4 complexed with fad, fmn, sf4, y3g |
PDB Entry: 7ljs (more details), 2 Å
SCOPe Domain Sequences for d7ljsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljsa2 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd
Timeline for d7ljsa2:
View in 3DDomains from same chain: (mouse over for more information) d7ljsa1, d7ljsa3, d7ljsa4, d7ljsa5 |