Lineage for d1ffvc1 (1ffv C:178-287)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182994Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2183157Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2183158Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 protein domains)
  6. 2183165Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 2183166Species Hydrogenophaga pseudoflava [TaxId:47421] [55451] (2 PDB entries)
  8. 2183167Domain d1ffvc1: 1ffv C:178-287 [40223]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb1, d1ffvb2, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve1, d1ffve2, d1ffvf2
    complexed with fad, fes, pcd

Details for d1ffvc1

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
PDB Compounds: (C:) cutm, flavoprotein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvc1 d.87.2.1 (C:178-287) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
gtgwayeklkrktgdwatagcavvmrksgntvshirialtnvaptalraeaaeaallgka
ftkeavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca

SCOPe Domain Coordinates for d1ffvc1:

Click to download the PDB-style file with coordinates for d1ffvc1.
(The format of our PDB-style files is described here.)

Timeline for d1ffvc1: